- CPEB4 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-81384
- Immunocytochemistry/ Immunofluorescence
- CPEB4
- PBS (pH 7.2) and 40% Glycerol
- Unconjugated
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: GDYGFGVLVQ SNTGNKSAFP VRFHPHLQPP HHHQNATPSP AAFINNNTAA NGSSA
- 0.1 ml (also 25ul)
- Rabbit
- cytoplasmic polyadenylation element binding protein 4
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- CPE-BP4, hCPEB-4
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
GDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSA
Specifications/Features
Available conjugates: Unconjugated